Home/Store/Bioregulators
VIP 5 mg - Vasoactive Intestinal Peptide

VIP 5 mg - Vasoactive Intestinal Peptide

$55.00
Bioregulator!
compare to $80.00 Save 31%
Lyophilized powder
In stock: 15 available
Product Details

Description

VIP 5 mg Vasoactive Intestinal Peptide by Amino Vitality

Research Overview
Vasoactive Intestinal Peptide (VIP) is a 28-amino-acid neuropeptide widely distributed in the central and peripheral nervous systems. In research settings, VIP is examined for its potent vasodilatory, anti-inflammatory, and neuroprotective properties, as well as its capacity to regulate cyclic AMP signaling, cytokine expression, and microcirculatory dynamics.

Mechanism of Action in Research Studies
Studies indicate that VIP exerts its biological activity through VPAC1 and VPAC2 receptor pathways, leading to elevated intracellular cAMP and subsequent modulation of smooth-muscle relaxation, endothelial nitric oxide synthesis, and inflammatory gene suppression.

Properties of VIP 5 mg Vasoactive Intestinal Peptide

  • Chemical Formula: C₁₄₇H₂₃₇N₄₃O₄₃S
  • Molecular Mass: 3,326.8 Da
  • Synonyms: Vasoactive Intestinal Polypeptide, VIP, Phe⁸–Ala–VIP
  • Sequence: HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH₂
  • Structure: Linear 28–amino acid neuropeptide
  • Purity: >99% (HPLC Verified)
  • Form: Lyophilized powder

Care Information

Store in a cool, dry place away from light. If reconstituted, refrigerate. For long term storage (60+ days), freezing at -20°C is recommended to maintain integrity.

Delivery and Shipping

Orders will typically be fulfilled to the following carriers within 24 hours of payment.

USPS - 2 - 8 Business Days

UPS - 1-6 Business Days

UPS 2 Day Air

**Cold Shipping FEDEX Overnight** - Strongly recommended during warm weather) or when temperatures are above 75f.


Product Usage

This PRODUCT IS INTENDED AS A RESEARCH CHEMICAL ONLY. This designation allows the use of research chemicals strictly for in vitro testing and laboratory experimentation only. All product information available on this website is for educational purposes only. Bodily introduction of any kind into humans or animals is strictly forbidden by law. This product should only be handled by licensed, qualified professionals. This product is not a drug, food, or cosmetic and may not be misbranded, misused or mislabeled as a drug, food or cosmetic.




Show More
Save this product for later
VIP 5 mg - Vasoactive Intestinal Peptide
You May Also Like
On Sale
BPC-157 5 mg
BPC-157 5 mg
BPC-157 5 mg
Lyophilized Powder
compare to $89.99
Save 33%
$60.00
On Sale
Lab Solvent - Benzyl Alcohol Solution 10 mL
Lab Solvent - Benzyl Alcohol Solution 10 mL
Lab Solvent - Benzyl Alcohol Solution 10 mL
compare to $14.00
Save 36%
$9.00
On Sale
TB-500 5 mg
TB-500 5 mg
TB-500 5 mg
Lyophilized Powder
compare to $85.00
Save 41%
$50.00
On Sale
BPC-157 10 mg
BPC-157 10 mg
BPC-157 10 mg
Lyophilized Powder
compare to $100.00
Save 15%
$85.00
New!
FOXO4-DRI - Humanin Research Complex - FOXO4-DRI 10 mg x 3 vials + Humanin 10 mg x 4 vials
FOXO4-DRI - Humanin Research Complex - FOXO4-DRI 10 mg x 3 vials + Humanin 10 mg x 4 vials
FOXO4-DRI - Humanin Research Complex - FOXO4-DRI 10 mg x 3 vials + Humanin 10 mg x 4 vials
Lyophilized Powder
compare to $1 450.00
Save 23%
$1 120.00
New!
Adipotide (FTTP) 5 mg
Adipotide (FTTP) 5 mg
Adipotide (FTTP) 5 mg
Lyophilized Powder
compare to $99.00
Save 24%
$75.00
Hot!
GLOW Basic Research Complex 4W 70 MG  - (1) BPC-157 / TB-500 20 MG Blend + (1) GHK Basic 50 MG - 70 MG Total
GLOW Basic Research Complex 4W 70 MG - (1) BPC-157 / TB-500 20 MG Blend + (1) GHK Basic 50 MG - 70 MG Total
GLOW Basic Research Complex 4W 70 MG - (1) BPC-157 / TB-500 20 MG Blend + (1) GHK Basic 50 MG - 70 MG Total
Lyophilized powder
compare to $249.00
Save 12%
$220.00
New!
Lipo-C +Burn LCB-526 10 mL
Lipo-C +Burn LCB-526 10 mL
Lipo-C +Burn LCB-526 10 mL
Amino Blend in Sterile Water
compare to $125.00
Save 32%
$85.00
Great Deal!
GHRP-6 10 mg
GHRP-6 10 mg
GHRP-6 10 mg
Lyophilized Powder
compare to $42.00
Save 29%
$30.00
  • My Account
  • Track Orders
  • Favorites
  • Shopping Bag
Powered by Lightspeed
Display prices in:USD
Skip to main content
Amino Vitality
Menu
Buy Peptides
About
Contact Us
Catalog
ALL PRODUCTSAmino BlendsBioregulatorsBlendsBundle & SaveCapsulesComplexesView All
Helpful Links
Search ProductsAccountFavoritesShopping Bag
Contact Us

Customer Service:

Mon–Fri: 11:00 AM — 5:00 PM

Closed weekends

+1–714-371-6130

Terms & ConditionsPrivacy PolicyShipping & Payment InfoReturn PolicyReport Abuse

Copyright 2026 - Amino Vitality - All rights reserved

Powered by Lightspeed

RESEARCH USE ONLY DISCLAIMER

All products sold on this website are intended strictly for research, laboratory, and analytical purposes only. They are not for human consumption, medical use, veterinary use, or household use. These products are not drugs, food additives, or dietary supplements and have not been evaluated or approved by the U.S. Food and Drug Administration (FDA) for safety, efficacy, or any therapeutic purpose. Amino Vitality is a chemical supplier. Amino Vitality is not a compounding pharmacy or chemical compounding facility as defined under 503A of the Federal Food, Drug, and Cosmetic act. Amino Vitaliy is not an outsourcing facility as defined under 503B of the Federal Food, Drug, and Cosmetic act. The products we offer are not intended to diagnose, treat, cure or prevent any disease.


By purchasing from this website, the customer represents and warrants that:

They are a qualified researcher or laboratory professional.

They understand the research nature of the products.

They will use the products in compliance with all applicable laws and regulations.

They will not use these products for human or animal consumption.


The buyer assumes all responsibility for the safe handling, storage, and use of these products. The seller shall not be held liable for any misuse, improper handling, or unintended application.

Products may present unknown hazards and should be handled only by trained professionals using appropriate safety procedures.


KEEP OUT OF REACH OF CHILDREN.


By purchasing, you acknowledge that you have read, understood, and agreed to this disclaimer.