VIP 5 mg - Vasoactive Intestinal Peptide
$55.00
Top Seller!
compare to $80.00 Save 31%
Lyophilized powder
In stock: 7 available
Product Details
Description
VIP 5 mg Vasoactive Intestinal Peptide by Amino Vitality
Research Overview
Vasoactive Intestinal Peptide (VIP) is a 28-amino-acid neuropeptide widely distributed in the central and peripheral nervous systems. In research settings, VIP is examined for its potent vasodilatory, anti-inflammatory, and neuroprotective properties, as well as its capacity to regulate cyclic AMP signaling, cytokine expression, and microcirculatory dynamics.
Mechanism of Action in Research Studies
Studies indicate that VIP exerts its biological activity through VPAC1 and VPAC2 receptor pathways, leading to elevated intracellular cAMP and subsequent modulation of smooth-muscle relaxation, endothelial nitric oxide synthesis, and inflammatory gene suppression.
Properties of VIP 5 mg Vasoactive Intestinal Peptide
- Chemical Formula: C₁₄₇H₂₃₇N₄₃O₄₃S
- Molecular Mass: 3,326.8 Da
- Synonyms: Vasoactive Intestinal Polypeptide, VIP, Phe⁸–Ala–VIP
- Sequence: HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH₂
- Structure: Linear 28–amino acid neuropeptide
- Purity: >99% (HPLC Verified)
- Form: Lyophilized powder
Care Information
Delivery and Shipping
Orders will typically be fulfilled to the following carriers within 24 hours of payment.
USPS - 2 - 8 Business Days
UPS - 1-6 Business Days
UPS 2 Day Air
**Cold Shipping FEDEX Overnight** - Strongly recommended during warm weather) or when temperatures are above 75f.
Product Usage
This PRODUCT IS INTENDED AS A RESEARCH CHEMICAL ONLY. This designation allows the use of research chemicals strictly for in vitro testing and laboratory experimentation only. All product information available on this website is for educational purposes only. Bodily introduction of any kind into humans or animals is strictly forbidden by law. This product should only be handled by licensed, qualified professionals. This product is not a drug, food, or cosmetic and may not be misbranded, misused or mislabeled as a drug, food or cosmetic.
Save this product for later
VIP 5 mg - Vasoactive Intestinal Peptide
You May Also Like
On Sale
Lab Solvent - Benzyl Alcohol Solution 10 mL
Lab Solvent - Benzyl Alcohol Solution 10 mL
compare to $14.00
Save 36%
$9.00
Top Seller!
CJC/IPA Research Complex 4W 20 MG - (2) CJC-1295 Without DAC / Ipamorelin 10 MG Blend
CJC/IPA Research Complex 4W 20 MG - (2) CJC-1295 Without DAC / Ipamorelin 10 MG Blend
Lyophilized Powder
compare to $205.00
Save 22%
$160.00
New!
LCB-526 Amino Blend 10 mL
LCB-526 Amino Blend 10 mL
Contains Benzyl Alcohol in Sterile Water
compare to $125.00
Save 32%
$85.00
